Recombinant human 52 kDa repressor of the inhibitor of the protein kinase
| Name | Recombinant human 52 kDa repressor of the inhibitor of the protein kinase |
|---|---|
| Supplier | Cusabio |
| Catalog | CSB-EP018719HU |
| Category | Protein |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E.coli |
| Tag/Conjugation | His-SUMO-tag |
| SwissProt/Accession | O43422 |
| Gene | PRKRIR |
| Residue | 612-761aa |
| Sequence | MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT |
| Description | Partial of Isoform Long |
| Supplier Page | Shop |
Product images
