Recombinant Human Cytochrome c oxidase assembly protein 1 homolog
| Name | Recombinant Human Cytochrome c oxidase assembly protein 1 homolog |
|---|---|
| Supplier | Cusabio |
| Catalog | CSB-EP004170HU |
| Category | Protein |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E.coli |
| Tag/Conjugation | GST-tag |
| SwissProt/Accession | Q9GZY4 |
| Gene | COA1 |
| Residue | 38-146aa |
| Sequence | QKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE |
| Description | Partial of the full length of 1-146aa |
| Supplier Page | Shop |
Product images
