Recombinant Creatin Kinase M -type (canine)
| Name | Recombinant Creatin Kinase M -type (canine) |
|---|---|
| Supplier | Abcam |
| Catalog | ab197789 |
| Prices | $258.00 |
| Sizes | 20 µg |
| Applications | ELISA WB SDS-PAGE |
| Species Reactivities | Dog |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | >90% by SDS-PAGE. |
| SwissProt/Accession | P06732 |
| Gene | CKM |
| Residue | 2 to 381 |
| Sequence | HHHHHHGSGGSGPFGNTHNKFKLNYKPEEEYPDLTKHNNHMAKALTPEIY KKLRDKETPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYQVFKDLF DPIIQDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKG YTLPPHCSRGERRAVEKLSIEALNSLTGEFKGKYYPLKSMTEQEQQQLID DHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVIS MQKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGT GLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDISNA DRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK |
| Supplier Page | Shop |
Product images
![Anti-Creatine Kinase MM antibody [3E5BA5] ( ab110319 ) at 1 µg/ml + Recombinant Creatin Kinase M -type (canine) (ab197789) at 0.1 µg Secondary HRP conjugated Goat anti-mouse IgG (H&L) at 1/5000 dilution developed using the ECL technique Exposure time : 5 minutes Samples run on a 4-20% acrylamide gel, performed under reducing conditions and developed using the ECL technique. Membrane was blocked with 5% Milk in PBS, Primary antibody was incubated in 1% Milk in PBS and secondary antibody was incubated in 1X Blocking buffer ( ab126587 ). Predicted CKM band size: 43.1 kDa Observed CKM band size: 43 kDa](http://www.bioprodhub.com/system/product_images/pp_products/2/sub_1/20347_ab197789-236917-wb-protein.jpg)
Anti-Creatine Kinase MM antibody [3E5BA5] ( ab110319 ) at 1 µg/ml + Recombinant Creatin Kinase M -type (canine) (ab197789) at 0.1 µg Secondary HRP conjugated Goat anti-mouse IgG (H&L) at 1/5000 dilution developed using the ECL technique Exposure time : 5 minutes Samples run on a 4-20% acrylamide gel, performed under reducing conditions and developed using the ECL technique. Membrane was blocked with 5% Milk in PBS, Primary antibody was incubated in 1% Milk in PBS and secondary antibody was incubated in 1X Blocking buffer ( ab126587 ). Predicted CKM band size: 43.1 kDa Observed CKM band size: 43 kDa
Example of canine CKM protein performance when ran in an ELISA (Canine CKM SimpleStep ELISA, ab197749 ).