Cynomolgus Monkey CD3 delta + CD3 epsilon protein fragment
| Name | Cynomolgus Monkey CD3 delta + CD3 epsilon protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab200501 |
| Category | Protein |
| Prices | $630.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE |
| Species Reactivities | Monkey |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | > 92 % by SDS-PAGE. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P07766 |
| Gene | CD3E |
| Residue | 22 to 117 |
| Sequence | QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGD RLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMD |
| Supplier Page | Shop |
Product images
DTT-reduced SDS-PAGE analysis of ab200501 stained overnight with Coomassie Blue. DTT-reduced heterodimer protein migrates as 18-20 kDa and 25-40 kDa due to glyosylation.