Human 1-AGP acyltransferase 4 protein fragment
| Name | Human 1-AGP acyltransferase 4 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab163415 |
| Category | Protein |
| Prices | $402.00 |
| Sizes | 2 µg |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | Q9NRZ5 |
| Gene | AGPAT4 |
| Residue | 152 to 251 |
| Sequence | RKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRLK HHLLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTLLGVLNGKKYHA |
| Supplier Page | Shop |
Product images
ab163415 on a 12.5% SDS-PAGE stained with Coomassie Blue.