| Name | Active human BD2 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab116473 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 5 µg |
| Applications | FA SDS-PAGE HPLC |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 95 % by SDS-PAGE. ab116473 is purified by proprietary chromatographic techniques. Purity is greater than 98.0% as determined by RP-HPLC and SDS-PAGE. |
| Bioactivity | Determined by the ability to chemoattract Human dendritic immature cells at a concentration of 10,000-100,000ng/ml corresponding to a specific activity of 10-100IU/mg. |
| SwissProt/Accession | O15263 |
| Gene | DEFB4A |
| Residue | 24 to 64 |
| Sequence | GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP |
| Supplier Page | Shop |