| Name | Active human beta 2 Defensin full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab200271 |
| Category | Protein |
| Prices | $101.00 |
| Sizes | 5 µg |
| Applications | FA HPLC SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 98 % by SDS-PAGE. ab200271 is >98% pure as assessed by SDS-PAGE and HPLC analyses. |
| Bioactivity | Fully biologically active when compared to standard. Determined by its ability to chemoattract immature human dendritic cells using a concentration range of 10-100 ng/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | O15263 |
| Gene | DEFB4A |
| Residue | 24 to 64 |
| Sequence | GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP |
| Supplier Page | Shop |