| Name | Active human beta 2 Defensin full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab191748 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 20 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The ED 50 was determined by its ability to chemoattract immature Human dendritic cells using a concentration range of 1-50 ng/mL. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | O15263 |
| Gene | DEFB4A |
| Residue | 24 to 64 |
| Sequence | GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP |
| Supplier Page | Shop |