Human Acidic Calponin protein fragment
| Name | Human Acidic Calponin protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab116869 |
| Category | Protein |
| Prices | $402.00 |
| Sizes | 10 µg |
| Applications | SDS-PAGE WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | Q15417 |
| Gene | CNN3 |
| Residue | 230 to 329 |
| Sequence | DQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEP VIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE stained with Coomassie Blue showing ab116869 at approximately 36.63 kDa.