Active human beta Defensin 1 full length protein

Name Active human beta Defensin 1 full length protein
Supplier Abcam
Catalog ab191781
Category Protein
Prices $192.00
Sizes 20 µg
Applications SDS-PAGE FA
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >95% by SDS-PAGE .
Bioactivity The ED 50 was determined by the ability to chemoattract CD34+ dendritic cells using a concentration range of 0.1-1.0 µg/mL.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession P60022
Gene DEFB1
Residue 22 to 68
Sequence GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
Supplier Page Shop