Active human beta Defensin 1 full length protein

• Supplier: Abcam
• Catalog: ab191781
• Category: Protein
• Prices: $192.00
• Sizes: 20 µg
• Applications: SDS-PAGE FA
• Species Reactivities: Human
• Nature: Recombinant
• Source: E. coli
• Purity: >95% by SDS-PAGE .
• Bioactivity: The ED 50 was determined by the ability to chemoattract CD34+ dendritic cells using a concentration range of 0.1-1.0 µg/mL.
• Endotoxin: < 1.000 Eu/µg
• SwissProt/Accession: P60022
• Gene: DEFB1
• Residue: 22 to 68
• Sequence: GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK