| Name | Active human beta Defensin 3 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab200245 |
| Category | Protein |
| Prices | $101.00 |
| Sizes | 5 µg |
| Applications | HPLC SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 98 % by SDS-PAGE. Purity >98% by SDS-PAGE and HPLC analyses. |
| Bioactivity | Exhibits anti-microbial activity against gram-positive bacteria S. aureus and gram-negative P. aeruginosa and E.coli . |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P81534 |
| Gene | DEFB103B |
| Residue | 23 to 67 |
| Sequence | GIINTLQKYYCRVRGGRCAVLSCLPKEEQI GKCSTRGRKCCRRKK |
| Supplier Page | Shop |