Active human beta Defensin 3 full length protein

• Supplier: Abcam
• Catalog: ab191758
• Category: Protein
• Prices: $192.00
• Sizes: 20 µg
• Applications: FA SDS-PAGE
• Species Reactivities: Human
• Nature: Recombinant
• Source: E. coli
• Purity: >95% by SDS-PAGE .
• Bioactivity: The ED 50 was determined by its antimicrobial resistance to E.Coli and was determined to be < 3.0 ug/mL
• Endotoxin: < 1.000 Eu/µg
• SwissProt/Accession: P81534
• Gene: DEFB103B
• Residue: 23 to 67
• Sequence: GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK