| Name | Active human Betacellulin full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab123846 |
| Category | Protein |
| Prices | $302.00 |
| Sizes | 20 µg |
| Applications | HPLC FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 97 % by SDS-PAGE. ab123846 was purified by proprietary chromatographic techniques. Purity is greater than 97% as determined by HPLC and SDS-PAGE. |
| Bioactivity | The ED 50 , calculated by the dose-dependant proliferation of murine BALBC 3T3 cells (measured by 3H-thymidine uptake) is < 0.05 ng/ml; corresponding to a Specific Activity of > 2.0 ×10 7 IU/mg. |
| SwissProt/Accession | P35070 |
| Gene | BTC |
| Residue | 32 to 111 |
| Sequence | DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGR CRFVVA EQTPSCVCDEGYIGARCERVDLFY |
| Supplier Page | Shop |