Active human BMP4 full length protein

Name Active human BMP4 full length protein
Supplier Abcam
Catalog ab192131
Category Protein
Prices $192.00
Sizes 10 µg
Applications FA SDS-PAGE
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >95% by SDS-PAGE .
Bioactivity The ED(50) was determined by its ability to induce alkaline phosphatase production in mouse ATDC5 chondrogenic and was found to be in the range of 0.1-0.2 ug/mL.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession P12644
Gene BMP4
Residue 293 to 408
Sequence SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCP FPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKV VLKNYQEMVVEGCGCR
Supplier Page Shop