Active human BRD2 protein fragment

Name Active human BRD2 protein fragment
Supplier Abcam
Catalog ab196109
Category Protein
Prices $837.00
Sizes 100 µg
Applications FA SDS-PAGE
Species Reactivities Human
Nature Recombinant
Source E. coli
Tag/Conjugation His tag N-Terminus
Purity >= 98 % by SDS-PAGE.
Bioactivity BRD2 is incubated with biotinylated acetyl-histone peptide substrate in BRD assay buffer in a 10 µL reaction for 1 hour at RT.
SwissProt/Accession P25440
Gene BRD2
Residue 65 to 187
Sequence EVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYH KIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVL MAQTLEKIFLQKVASMPQEEQEL
Supplier Page Shop

Product images