Active human BRD3 protein fragment
| Name | Active human BRD3 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab196108 |
| Category | Protein |
| Prices | $837.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | GST tag N-Terminus |
| Purity | >= 99 % by SDS-PAGE. |
| Bioactivity | Enzyme was assayed using BRD3 Assay Kit. BRD3 protein is incubated with biotinylated acetylhistone peptide substrate in BRD assay buffer in a 10 µL reaction for 1 hour at RT. |
| SwissProt/Accession | Q15059 |
| Gene | BRD3 |
| Residue | 29 to 145 |
| Sequence | PSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIK NPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQA LEKIFLQKVAQMPQEEV |
| Supplier Page | Shop |
