Active human BRDT protein fragment
| Name | Active human BRDT protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab198111 |
| Category | Protein |
| Prices | $1,220.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | GST tag N-Terminus |
| Purity | > 97 % by SDS-PAGE. |
| Bioactivity | BRDT protein is incubated with biotinylated acetyl-histone peptide substrate in BRD assay buffer in a 10 µl reaction for 1 hour at RT. GSH acceptor beads are added, followed by Streptavidin-conjugated donor beads. After 1 hour incubation at RT, Alphacounts are measured. |
| SwissProt/Accession | Q58F21 |
| Gene | BRDT |
| Residue | 22 to 138 |
| Sequence | TKKNGRLTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIK NPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQA LEKLFMQKLSQMPQEEQ |
| Supplier Page | Shop |
