Human alpha 1,2 Mannosidase IA protein fragment
| Name | Human alpha 1,2 Mannosidase IA protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab114842 |
| Category | Protein |
| Prices | $420.00 |
| Sizes | 10 µg |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P33908 |
| Gene | MAN1A1 |
| Residue | 110 to 199 |
| Sequence | PGDPEAALEDNLARIRENHERALREAKETLQKLPEEIQRDILLEKKKVAQ DQLRDKAPFRGLPPVDFVPPIGVESREPADAAIREKRAKI |
| Supplier Page | Shop |
Product images
ab114842 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.