| Name | Human alpha 1 Fetoprotein protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab169839 |
| Category | Protein |
| Prices | $235.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >90% by SDS-PAGE. The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified. Sterile-filtered. |
| Bioactivity | As fusion protein fully derived from human protein, ab169839 can be used as coating matrix protein to replace human collagen type IV for human cell differentiation regulation study in vitro. ab169839 can be used in low serum or serum-free cell culture media to improve attachment and spreading of many normal and stem cells including human ES cell, endothelial, epithelial, hepatocytes and mesenchymal stem cells. ab169839 can be used to improve survival of primary cultures. |
| SwissProt/Accession | P02771 |
| Gene | AFP |
| Residue | 20 to 217 |
| Sequence | MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVK DALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSE EGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESS GGSNIEF GEFYFDLRLKGDK |
| Supplier Page | Shop |