Human alpha 1 Glycine Receptor protein fragment
| Name | Human alpha 1 Glycine Receptor protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab114750 |
| Category | Protein |
| Prices | $420.00 |
| Sizes | 10 µg |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P23415 |
| Gene | GLRA1 |
| Residue | 121 to 220 |
| Sequence | IWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDL KNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEE |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE Stained with Coomassie Blue showing ab114750 at approximately 36.63kDa.