| Name | Active human Cardiotrophin 1 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab134868 |
| Category | Protein |
| Prices | $352.00 |
| Sizes | 20 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . ab134868 was constructed as a fusion protein and was highly purified using affinity matrix from E. coli. After specific proteinase cleavage, native Cardiotrophin 1 protein was collected and suspended in PBS buffer. |
| Bioactivity | Measured in a cell proliferation assay using TF-1 Human erythroleukemic cells. The ED 50 for this effect is typically 0.25 – 0.85 ng/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q16619 |
| Gene | CTF1 |
| Residue | 2 to 201 |
| Sequence | SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQL QGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLL DAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPR AEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA |
| Supplier Page | Shop |