Human Apolipoprotein A II full length protein
| Name | Human Apolipoprotein A II full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab157897 |
| Category | Protein |
| Prices | $402.00 |
| Sizes | 10 µg |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | P02652 |
| Gene | APOA2 |
| Residue | 1 to 100 |
| Sequence | MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME KVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ |
| Supplier Page | Shop |
Product images
ab157897 on a 12.5% SDS-PAGE stained with Coomassie Blue.