Human Apolipoprotein A II full length protein

Name Human Apolipoprotein A II full length protein
Supplier Abcam
Catalog ab192286
Category Protein
Prices $515.00
Sizes 10 µg
Applications HPLC SDS-PAGE
Species Reactivities Human
Nature Recombinant
Source HEK 293 cells
Tag/Conjugation His tag C-Terminus
Purity >95% by SDS-PAGE . Determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession P02652
Gene APOA2
Residue 24 to 100
Sequence QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLT PLIKKAGTELVNFLSYFVELGTQPATQVDHHHHHH
Supplier Page Shop