Active human CD160 full length protein
| Name | Active human CD160 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab174001 |
| Category | Protein |
| Prices | $357.00 |
| Sizes | 100 µg |
| Applications | FA ELISA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized recombinant mouse HVEM Fc Chimera at 1 μg/ml,the concentration of ab174001 that produces 50% of the optimal binding response is appoximately 1.0-16 ng/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | O95971 |
| Gene | CD160 |
| Residue | 27 to 159 |
| Sequence | INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQ LRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGH FFSILFTETGNYTVTGLKQRQHLEFSHNEGTLS |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of reduced ab174001 stained overnight with Coomassie Blue. DTT-reduced Protein migrates as 22-28 kDa due to glycosylation.