Human ATPase Inhibitory Factor 1 full length protein
| Name | Human ATPase Inhibitory Factor 1 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab203538 |
| Category | Protein |
| Prices | $781.00 |
| Sizes | 100 µg |
| Applications | MS WB SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | >95% by SDS-PAGE . Assessed by densitometry. Purifed using Ni-NTA chromatography. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q9UII2 |
| Gene | ATPIF1 |
| Residue | 26 to 106 |
| Sequence | MKHHHHHHASGSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSRE QLAALKKHHEEEIVHHKKEIERLQKEIERHKQKIKMLKHDD |
| Supplier Page | Shop |
Product images
14% SDS-PAGE analysis of ab203538. Lane 1: Reduced and boiled sample, 2.5 μg/lane Lane 2: Non-reduced and non-boiled sample, 2.5 μg/lane