Recombinant Human PPIL1 Protein
| Name | Recombinant Human PPIL1 Protein |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBC1-18379 |
| Category | Protein |
| Prices | $229.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Purity | >95% pure by SDS-PAGE |
| Bioactivity | Specific activity is > 700 nmol/min/mg, and is defined as the amount of enzyme that cleaves 1nmole of suc-AAFP-PNA per minute at 37C in Tris-HCl pH 8.0 using chymotrypsin. |
| Gene | PPIL1 |
| Sequence | MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSGLEHHHHHH |
| Description | A recombinant protein corresponding to amino acids 1 - 166 of PPIL1 |
| Supplier Page | Shop |
Product images
![SDS-Page: PPIL1 Protein [NBC1-18379] - PPIL1, 19.3 kDa (174 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE](http://www.bioprodhub.com/system/product_images/pp_products/5/sub_1/21469_PPIL1%2520Protein-SDS-Page-NBC1-18379-img0001.jpg)
SDS-Page: PPIL1 Protein [NBC1-18379] - PPIL1, 19.3 kDa (174 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE