Recombinant Human Laminin gamma 1 Protein
| Name | Recombinant Human Laminin gamma 1 Protein |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00003915-P01 |
| Category | Protein |
| Prices | $369.00, $529.00 |
| Sizes | 10 µg, 25 µg |
| Applications | WB ELISA Array |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat Germ |
| Gene | LAMC1 |
| Sequence | MNKRRTSHRIWKNKLPEYMRRPKGPVTKLWRSMPAWLS |
| Description | Laminin gamma 1 (Human) GST-Tagged Recombinant Protein Source: Wheat Germ (in vitro) Amino Acid Sequence: MNKRRTSHRIWKNKLPEYMRRPKGPVTKLWRSMPAWLS |
| Supplier Page | Shop |
Product images
![Recombinant Human Laminin gamma 1 Protein [H00003915-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.](http://www.bioprodhub.com/system/product_images/pp_products/5/sub_1/20973_Recombinant-Human-Laminin-gamma-1-Protein-H00003915-P01-img0001.jpg)
Recombinant Human Laminin gamma 1 Protein [H00003915-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.