Recombinant Human Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Protein

Name Recombinant Human Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Protein
Supplier Novus Biologicals
Catalog H00079369-Q01
Category Protein
Prices $369.00, $529.00
Sizes 10 µg, 25 µg
Applications WB ELISA Array
Species Reactivities Human
Nature Recombinant
Source Wheat Germ
Bioactivity This protein is not active and should not be used for experiments requiring activity.
Gene B3GNT4
Sequence GGYVMSRATVRRLQAIMEDAELFPIDDVFVGMCLRRLGLSPMHHAGFKTFGIRRPLDPLDPCLYRGLLLVHRLSPLEMWTMWALVTDEGLKCAAGPIPQR
Description Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 (Human) GST-Tagged Recombinant Protein Source: Wheat Germ (in vitro) Amino Acid Sequence: GGYVMSRATVRRLQAIMEDAELFPIDDVFVGMCLRRLGLSPMHHAGFKTFGIRRPLDPLDPCLYRGLLLVHRLSPLEMWTMWALVTDEGLKCAAGPIPQR
Supplier Page Shop

Product images