Human Baf180 protein fragment
| Name | Human Baf180 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab198083 |
| Category | Protein |
| Prices | $837.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | >= 51 % by SDS-PAGE. |
| SwissProt/Accession | Q86U86 |
| Gene | PBRM1 |
| Residue | 782 to 872 |
| Sequence | MHHHHHHIHNLFVSVMSHQDDEGRCYSDSLAEIPAVDPNFPNKPPLTFDI IRKNVENNRYRRLDLFQEHMFEVLERARRMNRTDSEIYEDAVELQQF |
| Supplier Page | Shop |
Product images
4-20% SDS PAGE analysis of ab198083 (2.6 μg).