Active human CD32B protein fragment
| Name | Active human CD32B protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab174051 |
| Category | Protein |
| Prices | $372.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by its ability to bind human IgG with an estimated KD <150 nM. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P31994 |
| Gene | FCGR2B |
| Residue | 46 to 217 |
| Sequence | KAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPS YRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETI VLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTG NIGYTLYSSKPVTITVQAPS |
| Supplier Page | Shop |
Product images
The purity of ab174051 was determined by reduced SDS PAGE and staining overnight with Coomassie Blue. Lane 1: MW markers Lane 2: ab174051 (predicted MW 20kDa), DTT-reduced ab174051 migrates as 23-33 kDa due to different glycosylation.