Active human CD70 protein fragment
| Name | Active human CD70 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab184733 |
| Category | Protein |
| Prices | $883.00 |
| Sizes | 200 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | > 92 % by SDS-PAGE. |
| Bioactivity | Immobilized mouse CD27 at 2 μg/ml (100 μl/well) can bind Human CD70 with a linear range of 62 - 1000 pg/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P32970 |
| Gene | CD70 |
| Residue | 39 to 193 |
| Sequence | QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHG PELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASR SISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGV QWVRP |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of reduced ab184733 stained overnight with Coomassie Blue. DTT-reduced protein migrates as 55-60 kDa, 110-120 kDa and 160-170 kDa monomeric, dimeric and trimeric form respectively due to different glycosylation.