Human Blood Group Wrb protein fragment
| Name | Human Blood Group Wrb protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab159817 |
| Category | Protein |
| Prices | $402.00 |
| Sizes | 10 µg |
| Applications | ELISA WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| Gene | WRB |
| Residue | 29 to 101 |
| Sequence | PSFSSFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMDEFARYARLERK INKMTDKLKTHVKARTAQLAKIK |
| Supplier Page | Shop |
Product images
ab159817 on a 12.5% SDS-PAGE stained with Coomassie Blue.