Human Blooms Syndrome Protein Blm protein fragment
| Name | Human Blooms Syndrome Protein Blm protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab152235 |
| Category | Protein |
| Prices | $402.00 |
| Sizes | 10 µg |
| Applications | WB SDS-PAGE ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P54132 |
| Gene | BLM |
| Residue | 1196 to 1295 |
| Sequence | SSVKKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVT LKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDS |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE analysis of ab152235 stained with Coomassie Blue.