Recombinant Human Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein

Name Recombinant Human Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein
Supplier Novus Biologicals
Catalog H00002799-Q01
Category Protein
Prices $369.00, $529.00
Sizes 10 µg, 25 µg
Applications WB ELISA Array
Species Reactivities Human
Nature Recombinant
Source Wheat Germ
Bioactivity This protein is not active and should not be used for experiments requiring activity.
Gene GNS
Sequence VRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRFSKHL
Description Glucosamine (N-acetyl)-6-Sulfatase/GNS (Human) GST-Tagged Recombinant Protein Source: Wheat Germ (in vitro) Amino Acid Sequence: VRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRFSKHL
Supplier Page Shop

Product images