Human Brachyury / Bry protein fragment
| Name | Human Brachyury / Bry protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab114236 |
| Category | Protein |
| Prices | $420.00 |
| Sizes | 10 µg |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | O15178 |
| Gene | T |
| Residue | 222 to 320 |
| Sequence | ERSDHKEMMEEPGDSQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLP STHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNW |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE showing ab114236 at approximately 36.52kDa stained with Coomassie Blue.