Recombinant Human NHE6/SLC9A6 Protein

Name Recombinant Human NHE6/SLC9A6 Protein
Supplier Novus Biologicals
Catalog H00010479-Q01
Category Protein
Prices $369.00, $529.00
Sizes 10 µg, 25 µg
Applications WB ELISA Array
Species Reactivities Human
Nature Recombinant
Source Wheat Germ
Bioactivity This protein is not active and should not be used for experiments requiring activity.
Gene SLC9A7
Sequence YGDSTVNTEPATSSAPRRFMGNSSEDALDRELAFGDHELVIRGTRLVLPMDDSEPPLNLLDNTRHGPA
Description NHE6/SLC9A6 (Human) GST-Tagged Recombinant Protein Source: Wheat Germ (in vitro) Amino Acid Sequence: YGDSTVNTEPATSSAPRRFMGNSSEDALDRELAFGDHELVIRGTRLVLPMDDSEPPLNLLDNTRHGPA
Supplier Page Shop

Product images