Human BRD3 protein fragment
| Name | Human BRD3 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab196122 |
| Category | Protein |
| Prices | $837.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | > 88 % by SDS-PAGE. |
| SwissProt/Accession | Q15059 |
| Gene | BRD3 |
| Residue | 29 to 145 |
| Sequence | PSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIK NPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQA LEKIFLQKVAQMPQEEV |
| Supplier Page | Shop |
Product images
4-20% SDS-PAGE with Coomassie stain. Lane 1: 4.5 µg Human BRD3 protein fragment (ab196122) Lane 2: Protein marker
ab196122 is incubated with biotinylated acetyl-histone peptide substrate in assay buffer in a 10 µl reaction for 1 hour at RT. Nickel Chelate acceptor beads are added, followed by Streptavidin-conjugated donor beads. After 1 hour minute incubation at RT, signal is measured.