Recombinant Human Fc epsilon RI beta/MS4A2 Protein

Name Recombinant Human Fc epsilon RI beta/MS4A2 Protein
Supplier Novus Biologicals
Catalog H00002206-Q01
Category Protein
Prices $369.00, $529.00
Sizes 10 µg, 25 µg
Applications WB ELISA Array
Species Reactivities Human
Nature Recombinant
Source Wheat Germ
Bioactivity This protein is not active and should not be used for experiments requiring activity.
Gene MS4A1
Sequence MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQE
Description Fc epsilon RI beta/MS4A2 (Human) GST-Tagged Recombinant Protein Source: Wheat Germ (in vitro) Amino Acid Sequence: MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQE
Supplier Page Shop

Product images