Recombinant Human SHP-2/PTPN11 Protein

Name Recombinant Human SHP-2/PTPN11 Protein
Supplier Novus Biologicals
Catalog H00005781-P01
Category Protein
Prices $250.00
Sizes 2 µg
Applications WB ELISA Array
Species Reactivities Human
Nature Recombinant
Source Wheat Germ
Bioactivity This protein is not active and should not be used for experiments requiring activity.
Gene PTPN11
Sequence MCLVKGDRRFSDEFTLHEMESGREAGMMEKARGEVLKKKLWKGKFQRGGF
Description SHP-2/PTPN11 (Human) GST-Tagged Recombinant Protein Source: Wheat Germ (in vitro) Amino Acid Sequence: MCLVKGDRRFSDEFTLHEMESGREAGMMEKARGEVLKKKLWKGKFQRGGF
Supplier Page Shop

Product images