Recombinant Human RPL39L Protein

Name Recombinant Human RPL39L Protein
Supplier Novus Biologicals
Catalog H00116832-P01
Category Protein
Prices $369.00, $529.00
Sizes 10 µg, 25 µg
Applications WB ELISA Array
Species Reactivities Human
Nature Recombinant
Source Wheat Germ
Bioactivity This protein is not active and should not be used for experiments requiring activity.
Gene RPL39L
Sequence MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL
Description RPL39L (Human) GST-Tagged Recombinant Protein (P01) Source: Wheat Germ (in vitro) Amino Acid Sequence: MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL
Supplier Page Shop

Product images