Recombinant Human OR13D1 Protein

Name Recombinant Human OR13D1 Protein
Supplier Novus Biologicals
Catalog H00286365-Q01
Category Protein
Prices $369.00, $529.00
Sizes 10 µg, 25 µg
Applications WB ELISA Array
Species Reactivities Human
Nature Recombinant
Source Wheat Germ
Bioactivity This protein is not active and should not be used for experiments requiring activity.
Gene OR13D1
Sequence YRFTDFDVSNISIYLNHVLFYTTQQAGDLEHMETRNYSAMTEFFLVGLSQYPELQ
Description OR13D1 (Human) GST-Tagged Recombinant Protein (Q01) Source: Wheat Germ (in vitro) Amino Acid Sequence: YRFTDFDVSNISIYLNHVLFYTTQQAGDLEHMETRNYSAMTEFFLVGLSQYPELQ
Supplier Page Shop

Product images