Recombinant Human RPL37A Protein

Name Recombinant Human RPL37A Protein
Supplier Novus Biologicals
Catalog H00006168-Q01
Category Protein
Prices $319.00
Sizes 2 µg
Applications WB ELISA Array
Species Reactivities Human
Nature Recombinant
Source Wheat Germ
Bioactivity This protein is not active and should not be used for experiments requiring activity.
Gene RPL37A
Sequence AKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRR
Description RPL37A (Human) GST-Tagged Recombinant Protein (Q01) Source: Wheat Germ (in vitro) Amino Acid Sequence: AKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRR
Supplier Page Shop

Product images