| Name | Recombinant Human SLC19A2 Protein |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00010560-Q01 |
| Category | Protein |
| Prices | $369.00, $529.00 |
| Sizes | 10 µg, 25 µg |
| Applications | WB ELISA Array |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat Germ |
| Bioactivity | This protein is not active and should not be used for experiments requiring activity. |
| Gene | SLC19A2 |
| Sequence | PMPQKSLFFHHIPSTCQRVNGIKVQNGGIVTDTPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLKVLWND |
| Description | SLC19A2 (Human) GST-Tagged Recombinant Protein (Q01) Source: Wheat Germ (in vitro) Amino Acid Sequence: PMPQKSLFFHHIPSTCQRVNGIKVQNGGIVTDTPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLKVLWND |
| Supplier Page | Shop |