Human C3orf10 full length protein
| Name | Human C3orf10 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab177597 |
| Category | Protein |
| Prices | $301.00 |
| Sizes | 100 µg |
| Applications | MS SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | >90% by SDS-PAGE. ab177597 was purified using conventional chromatography techniques. |
| SwissProt/Accession | Q8WUW1 |
| Gene | BRK1 |
| Residue | 1 to 75 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMGSMAGQEDPVQREIHQDWANREYIEIITS SIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGETLT |
| Supplier Page | Shop |
Product images
15% SDS-PAGE analysis of 3µg ab177597.