| Name | Active human Cripto1 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab190395 |
| Category | Protein |
| Prices | $371.00 |
| Sizes | 20 µg |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >90% by SDS-PAGE. ab190395 was refolded using a unique temperature shift inclusion body refolding technology and chromatographically purified. |
| Bioactivity | Measured by its binding ability in a functional ELSA. Immobilized recombinant Human Nodal protein at 2µg/ml (100µl/well) can bind rhCripto-1 with a linear range of 0.5-100 ng/ml. |
| SwissProt/Accession | P13385 |
| Gene | TDGF1 |
| Residue | 31 to 150 |
| Sequence | MASMTGGQQMGRGHHHHHHGNLYFQGGEFLGHQEFARPSRGYLAFRDDSI WPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSF YGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD |
| Supplier Page | Shop |