Recombinant Human ZNF266 Protein

Name Recombinant Human ZNF266 Protein
Supplier Novus Biologicals
Catalog H00010781-Q01
Category Protein
Prices $369.00, $529.00
Sizes 10 µg, 25 µg
Applications WB ELISA Array
Species Reactivities Human
Nature Recombinant
Source Wheat Germ
Bioactivity This protein is not active and should not be used for experiments requiring activity.
Gene ZNF266
Sequence GRAFTVSSCLSQHMKIHVGEKPYECKECGIAFTRSSQLTEHLKTHTAKDPFECKICGKSFRNSSCLSDHFRIH
Description ZNF266 (Human) GST-Tagged Recombinant Protein (Q01) Source: Wheat Germ (in vitro) Amino Acid Sequence: GRAFTVSSCLSQHMKIHVGEKPYECKECGIAFTRSSQLTEHLKTHTAKDPFECKICGKSFRNSSCLSDHFRIH
Supplier Page Shop

Product images