Human Calcitonin receptor protein fragment
| Name | Human Calcitonin receptor protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab114596 |
| Category | Protein |
| Prices | $420.00 |
| Sizes | 10 µg |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P30988 |
| Gene | CALCR |
| Residue | 394 to 474 |
| Sequence | CNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARAAAAAAEAGDIPIYIC HQELRNEPANNQGEESAEIIPLNIIEQESSA |
| Supplier Page | Shop |
Product images
ab114596 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.