Recombinant Human Dystrobrevin beta Protein

• Supplier: Novus Biologicals
• Catalog: H00001838-Q01
• Category: Protein
• Prices: $369.00, $529.00
• Sizes: 10 µg, 25 µg
• Applications: WB ELISA Array
• Species Reactivities: Human
• Nature: Recombinant
• Source: Wheat Germ
• Bioactivity: This protein is not active and should not be used for experiments requiring activity.
• Gene: DTNB
• Sequence: MIEESGNKRKTMAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHTTEISVSRLETVISSIY
• Description: Dystrobrevin beta (Human) GST-Tagged Recombinant Protein Source: Wheat Germ (in vitro) Amino Acid Sequence: MIEESGNKRKTMAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHTTEISVSRLETVISSIY