Recombinant Human Natriuretic Peptide Receptor C Protein
| Name | Recombinant Human Natriuretic Peptide Receptor C Protein |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00004883-Q01 |
| Category | Protein |
| Prices | $369.00, $529.00 |
| Sizes | 10 µg, 25 µg |
| Applications | WB ELISA Array |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat Germ |
| Gene | NPR3 |
| Sequence | RQEREALPPQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAA |
| Description | Natriuretic Peptide Receptor C (Human) GST-Tagged Recombinant Protein Source: Wheat Germ (in vitro) Amino Acid Sequence: RQEREALPPQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAA |
| Supplier Page | Shop |
Product images
![Recombinant Human Natriuretic Peptide Receptor C Protein [H00004883-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.](http://www.bioprodhub.com/system/product_images/pp_products/5/sub_1/20579_Recombinant-Human-Natriuretic-Peptide-Receptor-C-Protein-H00004883-Q01-img0001.jpg)
Recombinant Human Natriuretic Peptide Receptor C Protein [H00004883-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.