Human Calpain 15 protein fragment
| Name | Human Calpain 15 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab116957 |
| Category | Protein |
| Prices | $402.00 |
| Sizes | 10 µg |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | O75808 |
| Gene | CAPN15 |
| Residue | 993 to 1086 |
| Sequence | HPKAYLHVQCDCTDSFNVVSTRGSLRTQDSVPPLHRQVLVILSQLEGNAG FSITHRLAHRKAAQAFLSDWTASKGTHSPPLTPEVAGLHGPRPL |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE showing ab116957 at approximately 35.97kDa stained with Coomassie Blue.